General Information

  • ID:  hor004070
  • Uniprot ID:  Q9VG55
  • Protein name:  pyrokinin-2
  • Gene name:  Hug
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  Expressed during embryogenesis through to adult stages with highest expression at later half of embryogenesis and during larval stages. |Expressed in a subgroup of neurosecretory cells in the subesophageal ganglion from embryonic stage 9 to larval stages.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity; GO:0016084 myostimulatory hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle; GO:0030536 larval feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVPFKPRL
  • Length:  8(174-181)
  • Propeptide:  MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAEGATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD
  • Signal peptide:  MCGPSYCTLLLIAASCYILVCSHA
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probably has a role in larval molting.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  4*10(-7) M
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VG55-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004070_AF2.pdbhor004070_ESM.pdb

Physical Information

Mass: 106818 Formula: C45H74N12O10
Absent amino acids: ACDEGHIMNQTWY Common amino acids: P
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -20 Boman Index: -1193
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 85
Instability Index: 1926.25 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System.
  • PubMed ID:  14690519
  • Title:  Expression of a Novel Neuropeptide, NVGTLARDFQLPIPNamide, in the Larval and Adult Brain of Drosophila Melanogaster.
  • PubMed ID:  16054112
  • Title:  The Drosophila Gene CG9918 Codes for a pyrokinin-1 Receptor